PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen04g006370.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family ZF-HD
Protein Properties Length: 246aa    MW: 27699.2 Da    PI: 7.5743
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen04g006370.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer102.33.3e-3254106356
       ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRre 56 
                       k +YkeClkNhA+ +GghavDGCgEf+p+ ge+g++++lkCaAC+CHRnFHR+ 
  Sopen04g006370.1  54 KPKYKECLKNHAVGIGGHAVDGCGEFLPA-GEDGSIDSLKCAACNCHRNFHRKI 106
                       679*************************9.999*******************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF047702.6E-2856105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-2156105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015662.6E-3056105IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.50657106IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.601.9E-29170245IPR009057Homeodomain-like
SuperFamilySSF466892.5E-18172244IPR009057Homeodomain-like
PROSITE profilePS500718.633181245IPR001356Homeobox domain
TIGRFAMsTIGR015651.4E-23183239IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
GO:0042803Molecular Functionprotein homodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MEFEDQQKQR DEEIAAAPRH NDSLDNSELT TKMPLSPQLE LEPLTAVQLW TNNKPKYKEC  60
LKNHAVGIGG HAVDGCGEFL PAGEDGSIDS LKCAACNCHR NFHRKIAPPP LTAAATGGGE  120
PVPFVYHSHN QLPTYYRTLP PPCGYLQYHV APNQRPLALP STSGGYREDQ EDISHPNYSG  180
GSKKRFRTKF SQVQKDKMQE LADKLGWRIQ RDDEELVQQL CNETGITRQV FKVWMHNNKH  240
TLGKKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh5_A4e-211832411775ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015072308.10.0PREDICTED: zinc-finger homeodomain protein 2-like
SwissprotA2Z2593e-69ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH53e-69ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLK4BPT01e-174K4BPT0_SOLLC; Uncharacterized protein
STRINGSolyc04g014260.1.11e-173(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.17e-65homeobox protein 22